Adenine Nucleotide Translocator 2 Antibody FITC

Product no.: ANT2-FITC
$350.00


General Information

 

 

Product

 

Adenine Nucleotide Translocator 2 Antibody FITC-Conjugated

Description

FITC-Conjugated ADP/ATP Translocase 2 Antibody

Verified Applications

CM, ELISA, ICC, IF, IHC, IP, WB

Host

Rabbit

Species Cross Reactivity

Human, Mouse, Rat

Immunogen

Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.

 

Sequence:

AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK


Physical Properties

 

 

Quantity

 

100 µg

Volume

200 µl

Concentration

0.59-0.68 µg/µl in antibody stabilization buffer

Form

FITC-Conjugated

Clonality

Polyclonal

Storage

-20C for long term storage


Application Protocol

 

Confocal Microscopy

 

1:100

DB

1:10,000

ELISA

1:10,000

Immunocytochemistry

1:100

Immunofluorescence

1:100

Immunohistochemistry

1:100

Immunoprecipitation

1:200

Western Blot

1:500. Molecular Weight: 33-36 kDa.


Protein

 

Uniprot #

 

P05141

Overview

Catalyzes exchange of cytoplasmic ADP with mitochondrial ATP across mitochondrial inner membrane.  May also play role in chromosome segregation.

Molecular Function

Chromosome partition; Host-virus interaction; Transport

Subcellular Location

Mitochondrion inner membrane; multipass membrane protein

Expression

Acetylation, Methylation

Structure

Homodimer, Component of MMXD complex.

Alternative Nomenclature

2F1 antibody

AAC2 antibody

Adenine nucleotide translocator 2 antibody

ADP antibody

ADP ATP carrier protein 2 antibody

ANT2 antibody

ATP carrier protein 2 antibody

fibroblast isoform antibody

SLC25A5 antibody

Solute carrier family 25 member 5 antibody

T2 antibody

T3 antibody

   

Protein information supplied by UniProt
 

 

Accessories

Product Note Status Price
Adenine Nucleotide Translocator 2 Antibody Adenine Nucleotide Translocator 2 Antibody
ANT2-201AP $265.00 *
Adenine Nucleotide Translocator 2 Blocking Peptide Adenine Nucleotide Translocator 2 Blocking Peptide
P-ANT2 $145.00 *
Adenine Nucleotide Translocator 2 Antibody BIOTIN Adenine Nucleotide Translocator 2 Antibody BIOTIN
ANT2-BIOTIN $350.00 *
Adenine Nucleotide Translocator 2 Positive Control Adenine Nucleotide Translocator 2 Positive Control
PC-ANT2 $185.00 *
Display accessory details