E2F1 Antibody

Product no.: E2F1-101AP
$295.00


General Information

 

 

Product

 

E2F1 Antibody

Description

Affinity Purified E2F transcription factor 1 Antibody N-epitope

Verified Applications

ELISA, IP, WB

Host

Rabbit

Species Cross Reactivity

Human, Mouse Rat

Immunogen

Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.

 

Sequence:

PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD

Accession #

NCBI: NM_005225.2


Physical Properties

 

 

Quantity

 

100 µg

Volume

200 µl

Concentration

0.65 µg/µl in antibody stabilization buffer

Form

Affinity Purified

Clonality

Polyclonal

Determinant

N-epitope

Storage

-20C for long term storage


Application Protocol

 

DB

1:10,000

ELISA

1:10,000

Immunoprecipitation 1:200

Western Blot

1:1,000


Protein

 

 

Uniprot #

 

Q01094

Overview

Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site.

Molecular Function

DNA-binding; Apoptosis

Subcellular Location

Nucleus

Structure

Component of DRTF1/E2F transcription factor complex.  Forms heterodimers with DP family members.

Alternative Nomenclature

Dmel\CG6376 antibody

drosE2F1 antibody

E(Sev-CycE)3A antibody

E(var)3-93E antibody

Evar(3)164 antibody

l(3)07172 antibody

l(3)j3B1 antibody

l(3)j3C2 antibody

l(3)rM729 antibody

PBR 3 antibody

PRB binding protein E2F 1 antibody

RBAP 1 antibody

RBP 3 antibody

Retinoblastoma associated protein 1 antibody

Retinoblastoma binding protein 3 antibody

Transcription factor E2F1 antibody

Protein information supplied by UniProt
 

 

Accessories

Product Note Status Price
E2F1 Antibody FITC E2F1 Antibody FITC
E2F1n-FITC $350.00 *
E2F1 Antibody BIOTIN E2F1 Antibody BIOTIN
E2F1n-BIOTIN $350.00 *
E2F1 Blocking Peptide E2F1 Blocking Peptide
P-E2F1n $145.00 *
E2F1 Positive Control E2F1 Positive Control
PC-E2F1 $185.00 *
Display accessory details

We also recommend

E2F1-112AP
E2F1 Antibody
$295.00 *
E2F1-121AP
E2F1 Antibody
$295.00 *

Browse these categories as well: Forkhead Box, Transcription, Tumor Suppressors, Primaries