E2F1 Antibody

Product no.: E2F1-101AP

$320.00

General Information
Product	E2F1 Antibody
Description	Affinity Purified E2F transcription factor 1 Antibody N-epitope
Verified Applications	ELISA, IP, WB
Host	Rabbit
Species Cross Reactivity	Human, Mouse Rat
Immunogen	Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Accession #	NCBI: NM_005225.2
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.65 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Determinant	N-epitope
Storage	-20⁰C for long term storage
Application Protocol
DB	1:10,000
ELISA	1:10,000
Immunoprecipitation	1:200
Western Blot	1:1,000
Protein
Uniprot #	Q01094
Overview	Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site.
Molecular Function	DNA-binding; Apoptosis
Subcellular Location	Nucleus
Structure	Component of DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members.
Alternative Nomenclature	Dmel\CG6376 antibody drosE2F1 antibody E(Sev-CycE)3A antibody E(var)3-93E antibody Evar(3)164 antibody l(3)07172 antibody l(3)j3B1 antibody l(3)j3C2 antibody l(3)rM729 antibody PBR 3 antibody PRB binding protein E2F 1 antibody RBAP 1 antibody RBP 3 antibody Retinoblastoma associated protein 1 antibody Retinoblastoma binding protein 3 antibody Transcription factor E2F1 antibody

Protein information supplied by UniProt

Fabgennix E2F1 Antibody has been used in 1 Publication

Wang, Zhigang, et al. "Homocysteine inhibits adipogenesis in 3T3-L1 preadipocytes." Experimental Biology and Medicine 236.12 (2011): 1379-1388. PMID22114064

Western Blot; Mouse

Publishing research using E2F1-101AP? Please let us know, we can cite the reference in this datasheet.

Customer ratings for E2F1 Antibody

Number of ratings: 1
Average rating: 4

Good
from Verified Customer on 12/17/2020

Western blot preformed with human cell lysate (HeLa cell extracts). Reduced denaturing 10% SDS page tris glycine). Blocked for 1 hour with 5% milk. 1/500 primary antibody dilution for 16 hours in 5% milk in TNT buffer.

All incoming ratings are posted by actual shop visitors / webshop customers and their content is checked by the operator by means of a visual inspection.