General Information |
|
Product |
Adenine Nucleotide Translocator 2 Peptide |
Description |
Antigenic Blocking Peptide ADP/ATP Translocase 2 Antibody |
Verified Applications |
Immunocompetition, Immunodepletion |
Peptide Description |
Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.
Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK |
|
|
Quantity |
250 µg |
Volume |
100 µl |
Form |
Antigenic Blocking Peptide |
Storage |
-20⁰C for long term storage |
|
|
Competition/Depletion assay |
Refer to competition assay protocol |
|
|
Uniprot # |
|
Overview |
Catalyzes exchange of cytoplasmic ADP with mitochondrial ATP across mitochondrial inner membrane. May also play role in chromosome segregation. |
Molecular Function |
Chromosome partition; Host-virus interaction; Transport |
Subcellular Location |
Mitochondrion inner membrane; multipass membrane protein |
Expression |
Acetylation, Methylation |
Structure |
Homodimer, Component of MMXD complex. |
Alternative Nomenclature |
2F1 antibody AAC2 antibody Adenine nucleotide translocator 2 antibody ADP antibody ADP ATP carrier protein 2 antibody ANT2 antibody ATP carrier protein 2 antibody fibroblast isoform antibody SLC25A5 antibody Solute carrier family 25 member 5 antibody T2 antibody T3 antibody |
Protein information supplied by UniProt
Product | Note | Status | Price | |
---|---|---|---|---|
|
ANT2-201AP | |||
|
ANT2-FITC | |||
|
ANT2-BIOTIN | |||
|
PC-ANT2 | |||
Display accessory details |
Select your currency:
(c) FabGennix International Inc.