General Information |
|
Product |
Adenine Nucleotide Translocator 2 Antibody BIOTIN-Conjugated |
Description |
BIOTIN-Conjugated ADP/ATP Translocase 2 Antibody |
Verified Applications |
CM, ELISA, ICC, IF, IHC, IP, WB |
Host |
Rabbit |
Species Cross Reactivity |
Human, Mouse, Rat |
Immunogen |
Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.
Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK |
|
|
Quantity |
100 µg |
Volume |
200 µl |
Concentration |
0.59-0.68 µg/µl in antibody stabilization buffer |
Form |
BIOTIN-Conjugated |
Clonality |
Polyclonal |
Storage |
-20⁰C for long term storage |
|
|
Confocal Microscopy |
1:100 |
DB |
1:10,000 |
ELISA |
1:10,000 |
Immunocytochemistry |
1:100 |
Immunofluorescence |
1:100 |
Immunohistochemistry |
1:100 |
Immunoprecipitation |
1:200 |
Western Blot |
1:500. Molecular Weight: 33-36 kDa. |
|
|
Uniprot # |
|
Overview |
Catalyzes exchange of cytoplasmic ADP with mitochondrial ATP across mitochondrial inner membrane. May also play role in chromosome segregation. |
Molecular Function |
Chromosome partition; Host-virus interaction; Transport |
Subcellular Location |
Mitochondrion inner membrane; multipass membrane protein |
Expression |
Acetylation, Methylation |
Structure |
Homodimer, Component of MMXD complex. |
Alternative Nomenclature |
2F1 antibody AAC2 antibody Adenine nucleotide translocator 2 antibody ADP antibody ADP ATP carrier protein 2 antibody ANT2 antibody ATP carrier protein 2 antibody fibroblast isoform antibody SLC25A5 antibody Solute carrier family 25 member 5 antibody T2 antibody T3 antibody |
Protein information supplied by UniProt
Product | Note | Status | Price | |
---|---|---|---|---|
|
P-ANT2 | |||
|
ANT2-201AP | |||
|
ANT2-FITC | |||
|
PC-ANT2 | |||
Display accessory details |
Select your currency:
(c) FabGennix International Inc.