ACTH Antibody

Product no.: ACTH-101AP
$295.00
$265.00


General Information

 

 

Product

 

ACTH Antibody

Description

Affinity Purified Adrenocorticotropin Hormone Antibody

Verified Applications

ELISA, IHC-Fr, IHC-P, IP, WB

Host

Rabbit

Species Cross Reactivity

Human, Monkey, Mouse, Rat

 

Predicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep

Immunogen

Synthetic peptide corresponding to ACTH aa 138-176. 

 

Sequence:

 

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

Accession #

NCBI:  AAX36901


Physical Properties

 

 

Quantity

 

100 µg

Volume

200 µl

Concentration

0.67-0.68 µg/µl in antibody stabilization buffer

Form

Affinity Purified

Clonality

Polyclonal

Storage

-20C for long term storage


Application Protocol

 

 

Confocal Microscopy

 

1:250

Immunocytochemistry

1:250

Immunofluorescence

1:200

Immunohistochemistry

1:250

Immunoprecipitation

1:200

Western Blot

1:1000 Predicted Molecular weight: 29 kDa


Protein

 

 

Uniprot #

 

UPI00004EBE53

Overview

Stimulates adrenal glands and release cortisol.

Molecular Function

GPCR; Hormone activity

Subcellular Location

Secreted

Expression

ACTH and MSH are produced by the pituitary gland

Structure

Belongs to POMC family

Alternative Nomenclature

Alpha Melanocyte Stimulating Hormone antibody

Beta Endorphin antibody

Beta Lipotropin antibody

Beta Melanocyte Stimulating Hormone antibody

Beta-endorphin antibody

CLIP antibody

Corticotropin Like Intermediary Peptide antibody

Met-enkephalin antibody

MSH antibody

NPP antibody

Opiomelanocortin prepropeptide antibody

POC antibody

POMC antibody

Tetracosactide antibody

Protein information supplied by UniProt
 

Accessories

Product Note Status Price
ACTH Antibody FITC ACTH Antibody FITC
ACTH-FITC $350.00 *
ACTH Antibody BIOTIN ACTH Antibody BIOTIN
ACTH-BIOTIN $350.00 *
ACTH Blocking Peptide ACTH Blocking Peptide
P-ACTH $145.00 *
ACTH Positive Control ACTH Positive Control
PC-ACTH $185.00 *
Display accessory details

Browse these categories as well: Neuropeptides & Hormones, Diagnostic Markers, Primaries, Endocrine System, Growth Factors, Tumor Biomarkers, Metabolism, Obesity