1 - 10 of 40 results

ACTH Antibody

Product no.: ACTH-101AP

$285.00

General Information
Product	ACTH Antibody
Description	Affinity Purified Adrenocorticotropin Hormone Antibody
Verified Applications	ELISA, IHC-Fr, IHC-P, IP, WB
Host	Rabbit
Species Cross Reactivity	Human, Monkey, Mouse, Rat Predicted: Chicken, Chimpanzee, Cow, Dog, Goat, Guinea pig, Macaque Monkey, Orangutan, Sheep
Immunogen	Synthetic peptide corresponding to ACTH aa 138-176. Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Accession #	NCBI: AAX36901
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.67-0.68 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
Confocal Microscopy	1:250
Immunocytochemistry	1:250
Immunofluorescence	1:200
Immunohistochemistry	1:250
Immunoprecipitation	1:200
Western Blot	1:1000 Predicted Molecular weight: 29 kDa
Protein
Uniprot #	UPI00004EBE53
Overview	Stimulates adrenal glands and release cortisol.
Molecular Function	GPCR; Hormone activity
Subcellular Location	Secreted
Expression	ACTH and MSH are produced by the pituitary gland
Structure	Belongs to POMC family
Alternative Nomenclature	Alpha Melanocyte Stimulating Hormone antibody Beta Endorphin antibody Beta Lipotropin antibody Beta Melanocyte Stimulating Hormone antibody Beta-endorphin antibody CLIP antibody Corticotropin Like Intermediary Peptide antibody Met-enkephalin antibody MSH antibody NPP antibody Opiomelanocortin prepropeptide antibody POC antibody POMC antibody Tetracosactide antibody

Protein information supplied by UniProt

Your datasheets states this antibody was raised against "aa 1-70 of ACTH." However, ACTH (AKA corticotropin) is only a 38 aa protein (aa 138-176 of POMC) that is formed from cleavage of POMC, see the uniprot file below. I wanted to confirm if this antibody was raised against amino acids 1-70 or 138-176 of POMC. http://www.uniprot.org/uniprot/P01189
- The ACTH antibodies were raised against 39 amino acid ACTH hormone. The Specification sheet specifies the range from where the peptide was selected. In this case the 39 AA are the complete ACTH hormone.
  
  ACTH human
  1-39
  SYS MEH FRW GKP VGK KRR PVK VYP NGA EDE SAE AFP LEF
What is the percentage of homology between the immune source sequence of this antibody and the dog sequence?
- Thank you for your email inquiry for the homology of our product ACTH-101AP with dog sequence. The antigen used for generating our ACTH antibody is 99.00% homologous to dog (Canis Lupus familiaris) ACTH sequence except for a single conservative substitution of Leucine to valine near the C-terminal end. OUr antibody wil label and detect dog ACTH peptide.

Customer ratings for ACTH Antibody

Number of ratings: 1
Average rating: 5

Excellent
from Anonymous on 11/13/2015

Western Blot
Pig Brain purified protein
Reduced Denaturing (4-12% Bis-Tris)
10 ug sample loaded
BSA used as blocking agent for 1 hour. 3% at 22C.
1:500 primary antibody dilution for 1 hour at 22C.
DCIP/NBT detection method
Bands: Specific: 5, 10, 15, 20 kDa.

All incoming ratings are posted by actual shop visitors / webshop customers and their content is checked by the operator by means of a visual inspection.

Accessories

Product

Note

Status

Price

ACTH Antibody FITC

ACTH-FITC

$375.00 *

ACTH Antibody BIOTIN

ACTH-BIOTIN

$375.00 *

ACTH Blocking Peptide

P-ACTH

$155.00 *

ACTH Positive Control

PC-ACTH

$200.00 *

General Information
Product	Alpha 1 Fetoprotein Antibody
Description	Affinity Purified alpha-fetoprotein Antibody
Verified Applications	ELISA, IHC, IP, WB
Host	Rabbit
Species Cross Reactivity	Human, Monkey, Rat
Immunogen	Full length native protein (purified) corresponding to Human alpha 1 Fetoprotein. Purified human alpha 1 Fetoprotein.
Accession #	GenBank: AAB58754.1
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.68 µg/µl in antibody stabilization buffer
Immunoglobulin	IgG
Form	Affinity Purified
Purification Method	Immobilized antigen affinity chromatography
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
ELISA	1:10,000
Immunohistochemistry	1:100
Immunoprecipitation	1:200
Western Blot	1:500
Protein
Uniprot #	P02771
Overview	Binds copper, nickel, fatty acids, bilirubin.
Molecular Function	Copper, Nickel; metal-binding
Subcellular Location	Secreted
Expression	Plasma. Synthesized by fetal liver and yolk sac.
Structure	Dimeric and trimeric forms have been found in addition to the monomeric form
Alternative Nomenclature	AFP antibody Alpha fetoglobulin antibody Alpha fetoprotein antibody Alpha-1-fetoprotein antibody Alpha-fetoglobulin antibody Alpha-fetoprotein antibody alpha-fetoprotein, Hereditary persistence of, included antibody FETA antibody Hereditary persistence of alpha fetoprotein antibody HPAFP antibody

General Information
Product	BTBD7 Antibody
Description	Affinity Purified BTB/POZ domain containing protein 7 Antibody
Verified Applications	CM, ELISA, ICC, IF, IHC, IP, WB
Species Cross Reactivity	Human, Mouse
Immunogen	Synthetic peptide taken within amino acid region 1050-1150 on human BTBD7 protein.
Accession #	NCBI: NP_001002860
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.61-0.68 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
Confocal Microscopy	1:200
DB	1:10,000
ELISA	1:10,000
Immunocytochemistry	1:200
Immunohistochemistry	1:200
Immunoprecipitation	1:200
Western Blot	1:500
Protein
Uniprot #	Q9P203
Overview	Mediator of epithelial dynamics and organ branching by promoting cleft progression.
Molecular Function	Developmental proteins
Subcellular Location	Nucleus
Expression	Induced following accumulation of fibronectin in forming clefts, leading to local expression of the cell-scattering SNAIL2 and suppresion of E-cadherin levels.
Alternative Nomenclature	5730507E09Rik antibody 8030448M07 antibody BTBD7 antibody E130118E17Rik antibody FUP1 antibody

General Information
Product	CCK4 / PTK7 Antibody
Description	Affinity Purified Protein Tyrosine Kinase 7 Antibody
Verified Applications	ELISA, ICC/IF, WB
Host	Rabbit
Species Cross Reactivity	Human, Mouse, Rat
Immunogen	Purified Protein tyrosine kinase 7 protein was emulsified in complete adjuvant and used to immunize the rabbits.
Accession #	NCBI: AAH50050
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.59 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal. The anti-serum was pre-cleared for tag protein and then affinity purified on immobilized PTK7 affinity chromatography.
Storage	-20⁰C for long term storage
Application Protocol
DB	1:10,000
ELISA	1:10,000
Immunofluorescence	1:500
Western Blot	1:500
Protein
Uniprot #	Q12852
Overview	Activator of JNK/SAPK pathway. Phosphorylates beta-casein, histone 1 and myelin basic protein in vitro.
Molecular Function	ATP-binding, magnesium, Nucleotide-binding.
Subcellular Location	Cytoplasm, Membrane, Peripheral membrane protein
Expression	Highly expressed in brain and kidney.
Structure	Interacts with MBIP.
Alternative Nomenclature	Colon carcinoma kinase 4 antibody Inactive tyrosine-protein kinase 7 antibody mPTK7/CCK4 antibody Serum response factor antibody Srf antibody

General Information
Product	MUC1 Antibody
Description	Affinity Purified Mucin 1, transmembrane Antibody
Verified Applications	ELISA, IHC, IP
Host	Rabbit
Species Cross Reactivity	Human, Monkey
Immunogen	Synthetic peptide corresponding to unique amino acid sequence on MUCIN1 protein.
Specificity	Will detect deglycosylated MUCIN1 protein.
Accession #	NCBI: NM_182741.1
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.65 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
Confocal Microscopy	1:200
DB	1:10,000
ELISA	1:10,000
Immunocytochemistry	1:200
Immunofluorescence	1:200
Immunohistochemistry	1:200
Immunoprecipitation	1:200
Western Blot	1:500
Protein
Uniprot #	P15941
Overview	The alpha subunit has cell adhesive properties. Can act both as an adhesion and an anti-adhesion protein. May provide a protective layer on epithelial cells against bacterial and enzyme attack.
Molecular Function	transcription cofactor activity
Subcellular Location	Cell membrane, Cytoplasm, Membrane, Nucleus, Secreted
Expression	Expressed on the apical surface of epithelial cells, especially of airway passages, breast and uterus. Also expressed in activated and unactivated T-cells. Overexpressed in epithelial tumors, such as breast or ovarian cancer and also in non-epithelial tumor cells. Isoform 7 is expressed in tumor cells only.
Alternative Nomenclature	ADMCKD antibody Breast carcinoma-associated antigen DF3 antibody CA 15 3 antibody CD227 antigen antibody DF3 antigen antibody EMA antibody Episialin antibody Epithelial basement membrane antigen antibody H23 antigen antibody KL 6 antibody MAM 6 antibody MCD antibody MCKD1 antibody MUC 1 antibody Peanut-reactive urinary mucin antibody Polymorphic epithelial mucin antibody Tumor associated epithelial membrane antigen antibody

General Information
Product	RASD2 Antibody
Description	Affinity Purified Ras homolog enriched in striatum Antibody
Verified Applications	ELISA, IHC ,IP, WB
Host	Rabbit
Species Cross Reactivity	Human, Monkey, Mouse, Rat
Immunogen	Synthetic peptide taken within amino acid region 250-317 on RASD2 protein.
Specificity	Will not cross react with RASD1/Dexras.
Accession #	GenBank: AAH36988.1
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.5 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
Dot Blot	1:10,000
ELISA	1:10,000
Immunohistochemistry	1:100
Immunoprecipitation	1:500
Western Blot	1:500-1:1,000
Protein
Uniprot #	Q8JZW1
Molecular Function	GTP binding
Alternative Nomenclature	GTP binding protein Rhes antibody MGC:4834 antibody Ras homolog enriched in striatum antibody RASD 2 antibody Rhes antibody TEM2 antibody Tumor endothelial marker 2 antibody

Fabgennix RASD2 Antibody has been used in 3 Publications
Eshraghi, Mehdi, et al. "RasGRP1 is a causal factor in the development of l-DOPA–induced dyskinesia in Parkinson’s disease." Science Advances 6.18 (2020). PMC5142824	Western blot; *Mouse*
Ishragi, Mehdi, et al. "RasGRP1 (CalDAG-GEF-II) Mediates L-DOPA-induced Dyskinesia in a Mouse Model of Parkinson Disease." bioRxiv (2019): 739631.	Western blot; *Mouse*
Harrison, Laura M., Samuel H. Muller, and Daniela Spano. “Effects of the Ras Homolog Rhes on Akt/Protein Kinase B and Glycogen Synthase Kinase 3 Phosphorylation in Striatum.” Neuroscience 236C (2013): 21–30. PMC3596425	Immunoprecipitation; *Mouse*

General Information
Product	TMPRSS2 Antibody Affinity Purified
Verified Applications	ELISA, IMM, WB
Host	Rabbit
Species Cross Reactivity	Human, Mouse
Immunogen	Synthetic peptide taken within amino acid region 470-530 on human TMPRSS2 protein.
Accession #	GenBank: BAB70683.1
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.59-0.68 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
DB	1:10,000
ELISA	1:10,000
Immunoprecipitation	1:200
Western Blot	1:500
Protein
Uniprot #	Q920K3
Molecular Function	scavenger receptor activity, serine-type endopeptidase activity
Alternative Nomenclature	D16Ertd61e antibody Epitheliasin antibody PP9284 antibody PRSS10 antibody Serine protease 10 antibody TMPRSS2 ERG FUSION GENE, INCLUDED antibody TMPRSS2 ETV1 FUSION GENE, INCLUDED antibody Transmembrane protease serine 2 catalytic chain antibody Transmembrane protease, serine 2, EC 3.4.219 antibody

General Information
Product	Alpha Fetoprotein Antibody Affinity Purified
Description	Affinity Purified Alpha-fetoprotein Antibody
Verified Applications	ELISA, IMM, WB
Host	Rabbit
Species Cross Reactivity	Mouse
Immunogen	Synthetic peptide taken within amino acid region 50-100 on mouse alpha-fetoprotein.
Accession #	GenBank: AAA37190.1
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.55-0.75 µg/µl in antibody stabilization buffer
Form	Affinity Purified
Clonality	Polyclonal
Storage	-20⁰C for long term storage
Application Protocol
DB	1:10,000
ELISA	1:10,000
Immunoprecipitation	1:150
Western Blot	1:500
Protein
Uniprot #	P07724
Overview	Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca2+, Na+, K+, fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc.
Molecular Function	Chaperone binding; Drug binding; DNA binding; Fatty acid binding; Oxygen binding; Pyridoxal phosphate binding; Toxic substance binding; Zinc ion binding
Subcellular Location	Secreted
Expression	Plasma
Structure	Belongs to the ALB/AFP/VDB family. Contains 3 albumin domains.
Alternative Nomenclature	AFP antibody Alpha fetoprotein precursor antibody Alpha-1-fetoprotein antibody Alpha-fetoglobulin antibody FETA antibody Hereditary persistence of alpha fetoprotein antibody HPAFP antibody

General Information
Product	CD10 Antibody
Description	Affinity Purified Neprilysin Antibody Multi-epitope
Verified Applications	CM, ELISA, ICC, IF, IHC, IP, WB
Host	Rabbit
Species Cross Reactivity	Human, Mouse, Rat
Immunogen	Multi-epitope synthetic peptides were used. A mixture of synthetic peptide taken within amino acid regions: 100-150, 200-250, 360-410, 450-500 and 700-750 on human Neprilysin protein.
Accession #	NCBI: NP_009218
Physical Properties
Quantity	100 µg
Volume	200 µl
Concentration	0.72-0.78 µg/µl in antibody stabilization buffer
Immunoglobulin	IgG
Form	Affinity Purified
Clonality	Polyclonal
Determinant	Multi-epitope
Storage	-20⁰C for long term storage
Application Protocol
ELISA	1:10,000
Immunocytochemistry	1:250
Immunofluorescence	1:250
Immunohistochemistry	1:250
Immunoprecipitation	1:250
Western Blot	1:500
Protein
Uniprot #	P08473
Overview	Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond. angiotensin maturation; cellular response to UV; replicative senescence
Molecular Function	Hydrolase, Metalloprotease, Protease
Subcellular Location	Cell membrane, Membrane
Expression	Adipose tissue; duodenum; kidney; small intestine
Structure	Belongs to the peptidase M13 family
Alternative Nomenclature	Atriopeptidase antibody CALLA antibody CD10 antibody Common acute lymphocytic leukemia antigen antibody DKFZp686O16152 antibody EC 3.4.24.11 antibody Enkephalinase antibody EPN antibody gp100 antibody Membrane metallo endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10) antibody Membrane metallo endopeptidase antibody MGC126681 antibody MGC126707 antibody MME antibody NEP antibody Neprilysin antibody Neutral endopeptidase antibody SFE antibody Skin fibroblast elastase antibody

NEPR-101AP CD10 Antibody $285.00 *	NEPR-112AP CD10 Antibody $285.00 *	NEPR-121AP CD10 Antibody $285.00 *
NEPR-131AP CD10 Antibody $285.00 *	NEPR-141AP CD10 Antibody $285.00 *	Recombinant Protein Antibody CD10 Antibody $285.00 *

Home page Primary Antibodies Neuroscience Neuropeptides & Hormones ACTH Antibody

Home page Primary Antibodies Cardiology Serum Proteins Alpha 1 Fetoprotein Antibody

Home page Primary Antibodies Cell Biology BTBD7 Antibody

Home page Primary Antibodies Cancer Research Tumor Associated CCK4 Antibody

Home page Primary Antibodies Cancer Research Tumor Associated MUC1 Antibody

Home page Primary Antibodies Neuroscience Cell markers & CAMs RASD2 Antibody

Home page Primary Antibodies Neuroscience Neurodegenerative Disease TMPRSS2 Antibody

Home page Primary Antibodies Cardiology Serum Proteins Alpha Fetoprotein Antibody

Home page Primary Antibodies Cancer Research CD Markers CD10 Antibody

Home page Primary Antibodies Cancer Research CD Markers CD10 Antibody

ACTH Antibody

Customer ratings for ACTH Antibody

Accessories

Alpha 1 Fetoprotein Antibody

Accessories

We also recommend

BTBD7 Antibody

Accessories

We also recommend

CCK4 Antibody

Customer ratings for CCK4 Antibody

Accessories

MUC1 Antibody

Accessories

We also recommend

RASD2 Antibody

Accessories

We also recommend

TMPRSS2 Antibody

Accessories

Alpha Fetoprotein Antibody

Accessories

CD10 Antibody

Accessories

We also recommend

CD10 Antibody

Accessories

We also recommend