General Information |
|
Product |
E2F1 Antibody BIOTIN-Conjugated |
Description |
BIOTIN-Conjugated E2F transcription factor 1 Antibody N-epitope |
Verified Applications |
ELISA, WB |
Host |
Rabbit |
Species Cross Reactivity |
Human, Mouse Rat |
Immunogen |
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1.
Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
Accession # |
NCBI: NM_005225.2 |
|
|
Quantity |
100 µg |
Volume |
200 µl |
Concentration |
0.65 µg/µl in antibody stabilization buffer |
Form |
BIOTIN-Conjugated |
Clonality |
Polyclonal |
Determinant |
N-epitope |
Storage |
-20⁰C for long term storage |
|
|
DB |
1:10,000 |
ELISA |
1:10,000 |
Western Blot |
1:1,000 |
|
|
Uniprot # |
|
Overview |
Transcription activator that binds DNA cooperatively with DP proteins through E2 recognition site |
Molecular Function |
DNA-binding; Apoptosis |
Subcellular Location |
Nucleus |
Structure |
Component of DRTF1/E2F transcription factor complex. Forms heterodimers with DP family members. |
Alternative Nomenclature |
Dmel\CG6376 antibody drosE2F1 antibody E(Sev-CycE)3A antibody E(var)3-93E antibody Evar(3)164 antibody l(3)07172 antibody l(3)j3B1 antibody l(3)j3C2 antibody l(3)rM729 antibody PBR 3 antibody PRB binding protein E2F 1 antibody RBAP 1 antibody RBP 3 antibody Retinoblastoma associated protein 1 antibody Retinoblastoma binding protein 3 antibody Transcription factor E2F1 antibody |
Protein information supplied by UniProt
Fabgennix E2F1 Antibody has been used in 1 Publication |
|
Wang, Zhigang, et al. "Homocysteine inhibits adipogenesis in 3T3-L1 preadipocytes." Experimental Biology and Medicine 236.12 (2011): 1379-1388. PMID22114064
|
Western Blot; Mouse |
Publishing research using E2F1-101AP? Please let us know, we can cite the reference in this datasheet.
Product | Note | Status | Price | |
---|---|---|---|---|
|
P-E2F1n | |||
|
E2F1-101AP | |||
|
E2F1n-FITC | |||
|
PC-E2F1 | |||
Display accessory details |
Select your currency:
(c) FabGennix International Inc.